PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010555411.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 26999.3 Da    PI: 6.3208
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010555411.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.24.4e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsst kl+eyss
  XP_010555411.1  9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTSKLFEYSS 59
                    68***********************************************96 PP

2K-box48.44.1e-17911701897
           K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                     + e+++L ke+ +  + +R++ G++L+ L+++eLqqLe++Le +l+++ +kK+e ++++i++lq+k  +l e+nk+Lr++
  XP_010555411.1  91 DSEHSRLSKELVEKSHRLRQMRGDELQGLDMEELQQLEKALEAGLNRVIEKKSEKIMNEINDLQRKGIQLMEQNKRLRQQ 170
                     568999999998889999************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.969161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-38160IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-32388IPR002100Transcription factor, MADS-box
CDDcd002652.17E-39377No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.46687181IPR002487Transcription factor, K-box
PfamPF014862.7E-1592170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TSKLFEYSSS  60
SMKKMIERHS SQSKNSEKLN RPSLELQLVD DSEHSRLSKE LVEKSHRLRQ MRGDELQGLD  120
MEELQQLEKA LEAGLNRVIE KKSEKIMNEI NDLQRKGIQL MEQNKRLRQQ GVQLMDENER  180
LGQRISNGYE RYGDAESENA VEEGGNSSES VTNAGNSTGA PVDCESSDTS LKLGLPYGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-20177177Myocyte-specific enhancer factor 2B
1tqe_Q3e-20177177Myocyte-specific enhancer factor 2B
1tqe_R3e-20177177Myocyte-specific enhancer factor 2B
1tqe_S3e-20177177Myocyte-specific enhancer factor 2B
3mu6_A3e-20371270Myocyte-specific enhancer factor 2A
3mu6_B3e-20371270Myocyte-specific enhancer factor 2A
3mu6_C3e-20371270Myocyte-specific enhancer factor 2A
3mu6_D3e-20371270Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010555411.11e-173PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-134SVP_ARATH; MADS-box protein SVP
TrEMBLI6TS441e-133I6TS44_BRAJU; MADS-box protein SVP
STRINGAT2G22540.11e-132(Arabidopsis thaliana)
STRINGBra038511.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-124MIKC_MADS family protein